Matrilin 3 antibody (Middle Region)
-
- Target See all Matrilin 3 (MATN3) Antibodies
- Matrilin 3 (MATN3)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Matrilin 3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Matrilin 3 antibody was raised against the middle region of MATN3
- Purification
- Affinity purified
- Immunogen
- Matrilin 3 antibody was raised using the middle region of MATN3 corresponding to a region with amino acids IELYAVGVDRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCA
- Top Product
- Discover our top product MATN3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Matrilin 3 Blocking Peptide, catalog no. 33R-3946, is also available for use as a blocking control in assays to test for specificity of this Matrilin 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATN3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Matrilin 3 (MATN3)
- Alternative Name
- Matrilin 3 (MATN3 Products)
- Background
- This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues.
- Molecular Weight
- 50 kDa (MW of target protein)
-