Matrilin 3 antibody (Middle Region)

Catalog No. ABIN633908

Product Details anti-Matrilin 3 Antibody

Target: Matrilin 3 (MATN3)

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Matrilin 3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Matrilin 3 antibody was raised against the middle region of MATN3

Purification: Affinity purified

Immunogen: Matrilin 3 antibody was raised using the middle region of MATN3 corresponding to a region with amino acids IELYAVGVDRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Matrilin 3 Blocking Peptide, catalog no. 33R-3946, is also available for use as a blocking control in assays to test for specificity of this Matrilin 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Matrilin 3

Target: Matrilin 3 (MATN3)

Alternative Name: Matrilin 3 (MATN3 Products)

Background: This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues.

Molecular Weight: 50 kDa (MW of target protein)