QPCT antibody

Catalog No. ABIN633915

Product Details anti-QPCT Antibody

Target: QPCT (Glutaminyl-Peptide Cyclotransferase (QPCT))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This QPCT antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: QPCT antibody was raised using a synthetic peptide corresponding to a region with amino acids SRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

QPCT Blocking Peptide, catalog no. 33R-8755, is also available for use as a blocking control in assays to test for specificity of this QPCT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QPCT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for QPCT

Target: QPCT (Glutaminyl-Peptide Cyclotransferase (QPCT))

Alternative Name: QPCT (QPCT Products)

Synonyms: GCT antibody, QC antibody, sQC antibody, QPCT antibody, 5730422A13Rik antibody, Qpctl1 antibody, RGD1562284 antibody, qpct antibody, glutaminyl-peptide cyclotransferase antibody, glutaminyl-peptide cyclotransferase (glutaminyl cyclase) antibody, glutaminyl-peptide cyclotransferase L homeolog antibody, QPCT antibody, Qpct antibody, M6_Spy0443 antibody, M5005_Spy_0416 antibody, M28_Spy0404 antibody, CJA_2408 antibody, CCNA_02733 antibody, Tsp_03182 antibody, qpct.L antibody

Background: QPCT is responsible for the biosynthesis of pyroglutamyl peptides. QPCT has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. It also catalyzes N-terminal pyroglutamate formation. In vitro, catalyzes pyroglutamate formation of N-terminally truncated form of APP amyloid-beta peptides [Glu-3]-beta-amyloid.

Molecular Weight: 38 kDa (MW of target protein)