GSTM1 antibody (N-Term)
-
- Target See all GSTM1 Antibodies
- GSTM1 (Glutathione S-Transferase mu 1 (GSTM1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GSTM1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GSTM1 antibody was raised against the N terminal of GSTM1
- Purification
- Affinity purified
- Immunogen
- GSTM1 antibody was raised using the N terminal of GSTM1 corresponding to a region with amino acids KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI
- Top Product
- Discover our top product GSTM1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GSTM1 Blocking Peptide, catalog no. 33R-4498, is also available for use as a blocking control in assays to test for specificity of this GSTM1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTM1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GSTM1 (Glutathione S-Transferase mu 1 (GSTM1))
- Alternative Name
- GSTM1 (GSTM1 Products)
- Synonyms
- GST1 antibody, GSTM1-1 antibody, GSTM1a-1a antibody, GSTM1b-1b antibody, GTH4 antibody, GTM1 antibody, H-B antibody, MU antibody, MU-1 antibody, GSTA3 antibody, Gstb-1 antibody, Gstb1 antibody, gst-mu antibody, gst1 antibody, gstm1 antibody, gstm2 antibody, gth4 antibody, gtm1 antibody, glutathione S-transferase mu 1 antibody, glutathione S-transferase M1 antibody, glutathione S-transferase, mu 1 antibody, glutathione S-transferase Mu 1 antibody, glutathione S-transferase mu 2 (muscle) antibody, glutathione S-transferase mu 1 L homeolog antibody, GSTM1 antibody, Gstm1 antibody, LOC100356307 antibody, GSTM2 antibody, LOC100731426 antibody, gstm1.L antibody
- Background
- Cytosolic and membrane-bound forms of glutathione S-transferase are two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. GSTM1 a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione.
- Molecular Weight
- 24 kDa (MW of target protein)
- Pathways
- Negative Regulation of Transporter Activity
-