MATN1 antibody (Middle Region)

Catalog No. ABIN633926

Product Details anti-MATN1 Antibody

Target: MATN1 (Matrilin 1, Cartilage Matrix Protein (MATN1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MATN1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Matrilin 1 antibody was raised against the middle region of MATN1

Purification: Affinity purified

Immunogen: Matrilin 1 antibody was raised using the middle region of MATN1 corresponding to a region with amino acids KYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Matrilin 1 Blocking Peptide, catalog no. 33R-4743, is also available for use as a blocking control in assays to test for specificity of this Matrilin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MATN1

Target: MATN1 (Matrilin 1, Cartilage Matrix Protein (MATN1))

Alternative Name: Matrilin 1 (MATN1 Products)

Synonyms: cmp antibody, crtm antibody, xmatn1 antibody, MGC64509 antibody, MGC108367 antibody, CMP antibody, CRTM antibody, Crtm antibody, Mat1 antibody, matrilin-1 antibody, matrilin 1, cartilage matrix protein L homeolog antibody, matrilin 1 antibody, matrilin 1, cartilage matrix protein antibody, matn1.L antibody, matn1 antibody, MATN1 antibody, Matn1 antibody

Background: This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins are thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues.

Molecular Weight: 54 kDa (MW of target protein)