EPHX1 antibody

Catalog No. ABIN633927

The Rabbit Polyclonal anti-EPHX1 antibody (ABIN633927) specifically detects EPHX1 in WB. The antibody is reactive with Human samples.

Quick Overview for EPHX1 antibody (ABIN633927)

Target: EPHX1 (Epoxide Hydrolase 1, Microsomal (Xenobiotic) (EPHX1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EPHX1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EPHX1 Antibody

Purification: Affinity purified

Immunogen: EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EPHX1 Blocking Peptide, (ABIN938858), is also available for use as a blocking control in assays to test for specificity of this EPHX1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPHX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EPHX1

Target: EPHX1 (Epoxide Hydrolase 1, Microsomal (Xenobiotic) (EPHX1))

Alternative Name: EPHX1

Background: Epoxide hydrolase is a critical biotransformation enzyme that converts epoxides from the degradation of aromatic compounds to trans-dihydrodiols which can be conjugated and excreted from the body. Epoxide hydrolase functions in both the activation and detoxification of epoxides. Mutations in this gene cause preeclampsia, epoxide hydrolase deficiency or increased epoxide hydrolase activity.

Molecular Weight: 53 kDa (MW of target protein)