Fibulin 1 antibody (N-Term)

Catalog No. ABIN633929

Product Details anti-Fibulin 1 Antibody

Target: Fibulin 1 (FBLN1)

Binding Specificity: N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Fibulin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FBLN1 antibody was raised against the N terminal of FBLN1

Purification: Affinity purified

Immunogen: FBLN1 antibody was raised using the N terminal of FBLN1 corresponding to a region with amino acids CCVKSQETGDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBLN1 Blocking Peptide, catalog no. 33R-1657, is also available for use as a blocking control in assays to test for specificity of this FBLN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBLN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Fibulin 1

Target: Fibulin 1 (FBLN1)

Alternative Name: FBLN1 (FBLN1 Products)

Synonyms: fbln1 antibody, FBLN antibody, FIBL1 antibody, fbln1c antibody, fbln1d antibody, wu:fc52c06 antibody, MGC115035 antibody, fibulin 1 antibody, fibulin 1 L homeolog antibody, FBLN1 antibody, fbln1 antibody, Fbln1 antibody, fbln1.L antibody, CpipJ_CPIJ017419 antibody

Background: Fibulin 1 is a secreted glycoprotein that becomes incorporated into a fibrillar extracellular matrix. Calcium-binding is apparently required to mediate its binding to laminin and nidogen. It mediates platelet adhesion via binding fibrinogen.

Molecular Weight: 72 kDa (MW of target protein)