SMPDL3B antibody (N-Term)

Catalog No. ABIN633930

Product Details anti-SMPDL3B Antibody

Target: SMPDL3B (Sphingomyelin phosphodiesterase, Acid-Like 3B (SMPDL3B))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SMPDL3B antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: SMPDL3 B antibody was raised against the N terminal of SMPDL3

Purification: Affinity purified

Immunogen: SMPDL3 B antibody was raised using the N terminal of SMPDL3 corresponding to a region with amino acids ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SMPDL3B Blocking Peptide, catalog no. 33R-4064, is also available for use as a blocking control in assays to test for specificity of this SMPDL3B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMPDL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SMPDL3B

Target: SMPDL3B (Sphingomyelin phosphodiesterase, Acid-Like 3B (SMPDL3B))

Alternative Name: SMPDL3B (SMPDL3B Products)

Synonyms: ASML3B antibody, 1110054A24Rik antibody, AU045240 antibody, Asml3b antibody, im:7137990 antibody, si:ch1073-55d10.1 antibody, sphingomyelin phosphodiesterase acid like 3B antibody, sphingomyelin phosphodiesterase, acid-like 3B antibody, SMPDL3B antibody, Smpdl3b antibody, smpdl3b antibody

Background: Located on chromosome 1, this gene encodes for acid sphingomyelinase-like phosphodiesterase 3b precursor protein.

Molecular Weight: 52 kDa (MW of target protein)