PON1 antibody (C-Term)

Catalog No. ABIN633935

The Rabbit Polyclonal anti-PON1 antibody has been validated for WB. It is suitable to detect PON1 in samples from Human.

Quick Overview for PON1 antibody (C-Term) (ABIN633935)

Target: PON1 (Paraoxonase 1 (PON1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PON1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PON1 Antibody

Binding Specificity: C-Term

Specificity: PON1 antibody was raised against the C terminal of PON1

Purification: Affinity purified

Immunogen: PON1 antibody was raised using the C terminal of PON1 corresponding to a region with amino acids ASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKA

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PON1 Blocking Peptide, (ABIN936890), is also available for use as a blocking control in assays to test for specificity of this PON1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PON1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PON1

Target: PON1 (Paraoxonase 1 (PON1))

Alternative Name: PON1

Background: PON1 hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. It is capable of hydrolyzing a broad spectrum of organophosphate substrates and a number of aromatic carboxylic acid esters. It may mediate an enzymatic protection of low density lipoproteins against oxidative modification and the consequent series of events leading to atheroma formation.

Molecular Weight: 39 kDa (MW of target protein)