GALNT10 antibody (N-Term)

Catalog No. ABIN633943

This Rabbit Polyclonal antibody specifically detects GALNT10 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for GALNT10 antibody (N-Term) (ABIN633943)

Target: GALNT10 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 10 (GalNAc-T10) (GALNT10))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GALNT10 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GALNT10 Antibody

Binding Specificity: N-Term

Specificity: GALNT10 antibody was raised against the N terminal Of Galnt10

Purification: Affinity purified

Immunogen: GALNT10 antibody was raised using the N terminal Of Galnt10 corresponding to a region with amino acids VPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GALNT10 Blocking Peptide, (ABIN5613716), is also available for use as a blocking control in assays to test for specificity of this GALNT10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNT10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GALNT10

Target: GALNT10 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 10 (GalNAc-T10) (GALNT10))

Alternative Name: GALNT10

Background: GALNT10 belongs to the polypeptide N-acetylgalactosaminyltransferase (pp-GalNAc-T) family. Polypeptide GalNAc transferases initiate the synthesis of mucin-type oligosaccharides by transferring GalNAc from UDP-GalNAc to the hydroxyl group of either a serine or threonine residue on the polypeptide acceptor. Following expression in insect cells, recombinant GalNAc transferase 10 showed significant GalNAcT activity toward mucin-derived peptides, and it utilized both nonglycosylated and glycosylated peptide substrates.

Molecular Weight: 31 kDa (MW of target protein)