Decorin antibody (C-Term)

Catalog No. ABIN633958

Product Details anti-Decorin Antibody

Target: Decorin (DCN)

Binding Specificity: C-Term

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Decorin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Decorin antibody was raised against the C terminal of DCN

Purification: Affinity purified

Immunogen: Decorin antibody was raised using the C terminal of DCN corresponding to a region with amino acids FCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Decorin Blocking Peptide, catalog no. 33R-2856, is also available for use as a blocking control in assays to test for specificity of this Decorin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Decorin

Target: Decorin (DCN)

Alternative Name: Decorin (DCN Products)

Synonyms: CSCD antibody, DSPG2 antibody, PG40 antibody, PGII antibody, PGS2 antibody, SLRR1B antibody, DC antibody, mDcn antibody, cscd antibody, dspg2 antibody, pg40 antibody, pgii antibody, pgs2 antibody, slrr1b antibody, decorin antibody, decorin L homeolog antibody, DCN antibody, Dcn antibody, dcn.L antibody, dcn antibody

Background: DCN is a small cellular or pericellular matrix proteoglycan that is closely related in structure to biglycan protein. DCN and biglycan are thought to be the result of a gene duplication. This protein is a component of connective tissue, binds to type I collagen fibrils, and plays a role in matrix assembly. It contains one attached glycosaminoglycan chain. This protein is capable of suppressing the growth of various tumor cell lines. There are multiple alternatively spliced transcript variants known for this gene. This gene is a candidate gene for Marfan syndrome.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process