ERLIN2 antibody (Middle Region)

Catalog No. ABIN633961

Product Details anti-ERLIN2 Antibody

Target: ERLIN2 (ER Lipid Raft Associated 2 (ERLIN2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERLIN2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ERLIN2 antibody was raised against the middle region of ERLIN2

Purification: Affinity purified

Immunogen: ERLIN2 antibody was raised using the middle region of ERLIN2 corresponding to a region with amino acids ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ERLIN2 Blocking Peptide, catalog no. 33R-1518, is also available for use as a blocking control in assays to test for specificity of this ERLIN2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERLIN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ERLIN2

Target: ERLIN2 (ER Lipid Raft Associated 2 (ERLIN2))

Alternative Name: ERLIN2 (ERLIN2 Products)

Synonyms: C8orf2 antibody, Erlin-2 antibody, NET32 antibody, SPFH2 antibody, SPG18 antibody, BC036333 antibody, C87251 antibody, Spfh2 antibody, Erlin-2-B antibody, erlin1 antibody, spfh1 antibody, spfh2 antibody, spfh2-B antibody, RGD1309010 antibody, SPFH domain-containing protein 2-A antibody, erlin2 antibody, erlin2-a antibody, erlin2-b antibody, spfh2-A antibody, ER lipid raft associated 2 antibody, erlin-2 antibody, Erlin-2 antibody, ER lipid raft associated 2 S homeolog antibody, ER lipid raft associated 2 L homeolog antibody, ERLIN2 antibody, erlin2 antibody, Tsp_03442 antibody, erln2 antibody, Erlin2 antibody, erlin2.S antibody, erlin2.L antibody

Background: ERLIN2 plays an important role in the early steps of the endoplasmic reticulum-associated degradation (ERAD) pathway. It is involved in ITPR1 degradation by the ERAD pathway.

Molecular Weight: 38 kDa (MW of target protein)