FCN1 antibody

Catalog No. ABIN633978

The Rabbit Polyclonal anti-FCN1 antibody (ABIN633978) specifically detects FCN1 in WB. The antibody is reactive with Human samples.

Quick Overview for FCN1 antibody (ABIN633978)

Target: FCN1 (Ficolin (Collagen/fibrinogen Domain Containing) 1 (FCN1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FCN1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FCN1 Antibody

Purification: Affinity purified

Immunogen: FCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FCN1 Blocking Peptide, (ABIN938964), is also available for use as a blocking control in assays to test for specificity of this FCN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FCN1

Target: FCN1 (Ficolin (Collagen/fibrinogen Domain Containing) 1 (FCN1))

Alternative Name: FCN1

Background: The ficolin family of proteins are characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. The collagen-like and the fibrinogen-like domains are also found separately in other proteins such as complement protein C1q, C-type lectins known as collectins, and tenascins. However, all these proteins recognise different targets, and are functionally distinct. Ficolin 1(FCN1) is predominantly expressed in the peripheral blood leukocytes, and has been postulated to function as a plasma protein with elastin-binding activity.

Molecular Weight: 32 kDa (MW of target protein)

Pathways: Complement System