CYP2C18 antibody (N-Term)

Catalog No. ABIN633982

This Rabbit Polyclonal antibody specifically detects CYP2C18 in WB. It exhibits reactivity toward Human.

Quick Overview for CYP2C18 antibody (N-Term) (ABIN633982)

Target: CYP2C18 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 18 (CYP2C18))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYP2C18 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CYP2C18 Antibody

Binding Specificity: N-Term

Specificity: CYP2 C18 antibody was raised against the N terminal of CYP2 18

Purification: Affinity purified

Immunogen: CYP2 C18 antibody was raised using the N terminal of CYP2 18 corresponding to a region with amino acids MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYP2C18 Blocking Peptide, (ABIN5613077), is also available for use as a blocking control in assays to test for specificity of this CYP2C18 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYP2C18

Target: CYP2C18 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 18 (CYP2C18))

Alternative Name: CYP2C18

Background: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Molecular Weight: 56 kDa (MW of target protein)