FETUB antibody (N-Term)

Catalog No. ABIN633997

Product Details anti-FETUB Antibody

Target: FETUB (Fetuin B (FETUB))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FETUB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FETUB antibody was raised against the N terminal of FETUB

Purification: Affinity purified

Immunogen: FETUB antibody was raised using the N terminal of FETUB corresponding to a region with amino acids GCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDAQEYRRGGLGSLFYL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FETUB Blocking Peptide, catalog no. 33R-3189, is also available for use as a blocking control in assays to test for specificity of this FETUB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FETUB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FETUB

Target: FETUB (Fetuin B (FETUB))

Alternative Name: FETUB (FETUB Products)

Synonyms: 16G2 antibody, Gugu antibody, IRL685 antibody, Fet antibody, Pp63 antibody, gugu antibody, fetuin-b antibody, FETUB antibody, 16g2 antibody, irl685 antibody, im:6910148 antibody, 2310011O17Rik antibody, AI255764 antibody, D17980 antibody, fetuin B antibody, fetuin B L homeolog antibody, fetuin beta antibody, FETUB antibody, Fetub antibody, fetub.L antibody, fetub antibody

Background: The protein encoded by this gene is a member of the fetuin family, part of the cystatin superfamily of cysteine protease inhibitors. Fetuins have been implicated in several diverse functions, including osteogenesis and bone resorption.

Molecular Weight: 42 kDa (MW of target protein)