+1 877 302 8632
+1 888 205 9894 (Toll-free)

FUCA1 antibody (Fucosidase, alpha-L- 1, Tissue) (Middle Region) Primary Antibody

FUCA1 Reactivity: Human, Mouse, Dog WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN634001
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    Binding Specificity
    • 15
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Middle Region
    • 33
    • 27
    • 10
    • 7
    • 4
    • 3
    • 3
    • 3
    • 3
    • 1
    • 1
    • 1
    Human, Mouse, Dog
    • 55
    • 4
    • 1
    • 58
    • 2
    • 30
    • 7
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    This FUCA1 antibody is un-conjugated
    • 34
    • 23
    • 13
    • 13
    • 11
    • 6
    • 5
    • 5
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    Western Blotting (WB)
    FUCA1 antibody was raised against the middle region of FUCA1
    Affinity purified
    FUCA1 antibody was raised using the middle region of FUCA1 corresponding to a region with amino acids TNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPL
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    FUCA1 Blocking Peptide, catalog no. 33R-9215, is also available for use as a blocking control in assays to test for specificity of this FUCA1 antibody

    For Research Use only
  • Format
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FUCA1 antibody in PBS
    Lot specific
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    Alternative Name
    FUCA1 (FUCA1 Antibody Abstract)
    FUCA, FUCA1, 0610006A03Rik, 9530055J05Rik, Afuc, Fuca, fuca, fuca1, ATFUC1, F24D13.11, F24D13_11, alpha-L-fucosidase 1, alpha-L-fucosidase 1, fucosidase, alpha-L- 1, tissue, alpha-L-fucosidase 1 L homeolog, FUCA1, Fuca1, fuca1.L, fuca1, FUC1, LOC9317020, LOC100285202
    Alpha-L-fucosidase (EC is a lysosomal enzyme involved in the degradation of fucose-containing glycoproteins and glycolipids. At least 2 separate polymorphic alpha-L-fucosidases are recognised in man.
    Molecular Weight
    54 kDa (MW of target protein)
    Glycosaminoglycan Metabolic Process
You are here:
help Support