PDIA6 antibody (N-Term)

Catalog No. ABIN634007

The Rabbit Polyclonal anti-PDIA6 antibody is suitable to detect PDIA6 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for PDIA6 antibody (N-Term) (ABIN634007)

Target: PDIA6 (Protein Disulfide Isomerase Family A, Member 6 (PDIA6))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDIA6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PDIA6 Antibody

Binding Specificity: N-Term

Specificity: PDIA6 antibody was raised against the N terminal of PDIA6

Purification: Affinity purified

Immunogen: PDIA6 antibody was raised using the N terminal of PDIA6 corresponding to a region with amino acids KNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDIA6 Blocking Peptide, (ABIN939957), is also available for use as a blocking control in assays to test for specificity of this PDIA6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDIA6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDIA6

Target: PDIA6 (Protein Disulfide Isomerase Family A, Member 6 (PDIA6))

Alternative Name: PDIA6

Background: Protein disulfide isomerases, such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling, Cell RedoxHomeostasis