PDIA6 antibody (N-Term)

Catalog No. ABIN634007

Product Details anti-PDIA6 Antibody

Target: PDIA6 (Protein Disulfide Isomerase Family A, Member 6 (PDIA6))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDIA6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PDIA6 antibody was raised against the N terminal of PDIA6

Purification: Affinity purified

Immunogen: PDIA6 antibody was raised using the N terminal of PDIA6 corresponding to a region with amino acids KNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDIA6 Blocking Peptide, catalog no. 33R-4571, is also available for use as a blocking control in assays to test for specificity of this PDIA6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDIA6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDIA6

Target: PDIA6 (Protein Disulfide Isomerase Family A, Member 6 (PDIA6))

Alternative Name: PDIA6 (PDIA6 Products)

Synonyms: 1700015E05Rik antibody, AL023058 antibody, C77895 antibody, CaBP5 antibody, P5 antibody, Txndc7 antibody, ERP5 antibody, TXNDC7 antibody, CaBP1 antibody, pdi-p5 antibody, erp5 antibody, pdia6 antibody, pdip5 antibody, txndc7 antibody, protein disulfide isomerase family A member 6 antibody, protein disulfide isomerase associated 6 antibody, protein disulfide isomerase family A, member 6 antibody, protein disulfide isomerase family A member 6 L homeolog antibody, PDIA6 antibody, Pdia6 antibody, pdia6.L antibody

Background: Protein disulfide isomerases, such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling, Cell RedoxHomeostasis