LYPD4 antibody (N-Term)

Catalog No. ABIN634028

Product Details anti-LYPD4 Antibody

Target: LYPD4 (LY6/PLAUR Domain Containing 4 (LYPD4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LYPD4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LYPD4 antibody was raised against the N terminal of LYPD4

Purification: Affinity purified

Immunogen: LYPD4 antibody was raised using the N terminal of LYPD4 corresponding to a region with amino acids MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LYPD4 Blocking Peptide, catalog no. 33R-6059, is also available for use as a blocking control in assays to test for specificity of this LYPD4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LYPD4

Target: LYPD4 (LY6/PLAUR Domain Containing 4 (LYPD4))

Alternative Name: LYPD4 (LYPD4 Products)

Synonyms: LYPD4 antibody, SMR antibody, 4933400F01Rik antibody, rCG53718 antibody, LY6/PLAUR domain containing 4 antibody, Ly6/Plaur domain containing 4 antibody, LYPD4 antibody, Lypd4 antibody

Background: The specific function of LYPD4 is not yet known.

Molecular Weight: 27 kDa (MW of target protein)