TOR3A antibody (Middle Region)

Catalog No. ABIN634037

Product Details anti-TOR3A Antibody

Target: TOR3A (Torsin Family 3, Member A (TOR3A))

Binding Specificity: Middle Region

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TOR3A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TOR3 A antibody was raised against the middle region of TOR3

Purification: Affinity purified

Immunogen: TOR3 A antibody was raised using the middle region of TOR3 corresponding to a region with amino acids FHFPHPKYVDLYKEQLMSQIRETQQLCHQTLFIFDEAEKLHPGLLEVLGP

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TOR3A Blocking Peptide, catalog no. 33R-2919, is also available for use as a blocking control in assays to test for specificity of this TOR3A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TOR3A

Target: TOR3A (Torsin Family 3, Member A (TOR3A))

Alternative Name: TOR3A (TOR3A Products)

Synonyms: TOR3A antibody, MGC107954 antibody, si:ch211-198n5.8 antibody, ADIR antibody, ADIR2 antibody, Adir antibody, torsin family 3 member A antibody, torsin family 3, member A antibody, TOR3A antibody, tor3a antibody, Tor3a antibody

Background: The function of TOR3A protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 46 kDa (MW of target protein)