RAN antibody (Middle Region)

Catalog No. ABIN634102

This Rabbit Polyclonal antibody specifically detects RAN in WB. It exhibits reactivity toward Human, Mouse, Rat, Dog, Drosophila melanogaster and C. elegans.

Quick Overview for RAN antibody (Middle Region) (ABIN634102)

Target: RAN (RAN, Member RAS Oncogene Family (RAN))

Reactivity: Human, Mouse, Rat, Dog, Drosophila melanogaster, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAN antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RAN Antibody

Binding Specificity: Middle Region

Specificity: Ran antibody was raised against the middle region of RAN

Purification: Affinity purified

Immunogen: Ran antibody was raised using the middle region of RAN corresponding to a region with amino acids NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Ran Blocking Peptide, (ABIN5615752), is also available for use as a blocking control in assays to test for specificity of this Ran antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAN

Target: RAN (RAN, Member RAS Oncogene Family (RAN))

Alternative Name: Ran

Background: RAN (ras-related nuclear protein) is a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex.

Molecular Weight: 24 kDa (MW of target protein)

Pathways: Regulatory RNA Pathways, Intracellular Steroid Hormone Receptor Signaling Pathway, Protein targeting to Nucleus