Septin 12 antibody (Middle Region)

Catalog No. ABIN634113

Product Details anti-Septin 12 Antibody

Target: Septin 12 (Sep12)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Septin 12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Septin 12 antibody was raised against the middle region of 40433

Purification: Affinity purified

Immunogen: Septin 12 antibody was raised using the middle region of 40433 corresponding to a region with amino acids LQRLCRTVNVVPVIARADSLTMEEREAFRRRIQQNLRTHCIDVYPQMCFD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Septin 12 Blocking Peptide, catalog no. 33R-5333, is also available for use as a blocking control in assays to test for specificity of this Septin 12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 41153 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Septin 12

Target: Septin 12 (Sep12)

Alternative Name: Septin 12 (Sep12 Products)

Synonyms: MGC68931 antibody, fe23c11 antibody, si:dkey-23a11.2 antibody, wu:fe23c11 antibody, SPGF10 antibody, 1700028G04Rik antibody, 4933413B09Rik antibody, Septin12 antibody, septin 12 S homeolog antibody, septin 12 antibody, sept12.S antibody, SEPT12 antibody, sept12 antibody, Sept12 antibody

Background: Septins, such as SEPT12, are conserved GTP-binding proteins that function as dynamic, regulatable scaffolds for the recruitment of other proteins. They are involved in membrane dynamics, vesicle trafficking, apoptosis, and cytoskeleton remodeling, as well as infection, neurodegeneration, and neoplasia.Septins, such as SEPT12, are conserved GTP-binding proteins that function as dynamic, regulatable scaffolds for the recruitment of other proteins.

Molecular Weight: 41 kDa (MW of target protein)