MCM9 antibody (N-Term)

Catalog No. ABIN634125

This anti-MCM9 antibody is a Rabbit Polyclonal antibody detecting MCM9 in WB. Suitable for Human and Mouse.

Quick Overview for MCM9 antibody (N-Term) (ABIN634125)

Target: MCM9 (Minichromosome Maintenance Deficient 9 (MCM9))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MCM9 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MCM9 Antibody

Binding Specificity: N-Term

Specificity: MCM9 antibody was raised against the N terminal of MCM9

Purification: Affinity purified

Immunogen: MCM9 antibody was raised using the N terminal of MCM9 corresponding to a region with amino acids NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MCM9 Blocking Peptide, catalog no. 33R-6870, is also available for use as a blocking control in assays to test for specificity of this MCM9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MCM9

Target: MCM9 (Minichromosome Maintenance Deficient 9 (MCM9))

Alternative Name: MCM9

Background: MCM9 is a protein that shares similarity with minichromosome maintenance (MCM) proteins, which are known to be essential for initiation of DNA replication.

Molecular Weight: 44 kDa (MW of target protein)