NCAPD2 antibody (C-Term)

Catalog No. ABIN634129

Product Details anti-NCAPD2 Antibody

Target: NCAPD2 (Non-SMC Condensin I Complex, Subunit D2 (NCAPD2))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NCAPD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NCAPD2 antibody was raised against the C terminal of NCAPD2

Purification: Affinity purified

Immunogen: NCAPD2 antibody was raised using the C terminal of NCAPD2 corresponding to a region with amino acids KAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSTGSRYQPL

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NCAPD2 Blocking Peptide, catalog no. 33R-4246, is also available for use as a blocking control in assays to test for specificity of this NCAPD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCAPD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NCAPD2

Target: NCAPD2 (Non-SMC Condensin I Complex, Subunit D2 (NCAPD2))

Alternative Name: NCAPD2 (NCAPD2 Products)

Synonyms: CAP-D2 antibody, CNAP1 antibody, hCAP-D2 antibody, 2810406C15Rik antibody, 2810465G24Rik antibody, mKIAA0159 antibody, RGD1562596 antibody, im:6902697 antibody, si:dkey-175g20.1 antibody, wu:fc13f08 antibody, wu:fx06e10 antibody, non-SMC condensin I complex subunit D2 antibody, non-SMC condensin I complex, subunit D2 antibody, non-SMC condensin I complex subunit D2 S homeolog antibody, condensin complex subunit 1 antibody, NCAPD2 antibody, Ncapd2 antibody, ncapd2.S antibody, CIMG_02087 antibody, BDBG_08990 antibody, MCYG_08389 antibody, VDBG_09812 antibody, MGYG_05811 antibody, ncapd2 antibody

Background: NCAPD2 is the regulatory subunit of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases. NCAPD2 may target the condensin complex to DNA via its C-terminal domain.

Molecular Weight: 157 kDa (MW of target protein)