NCAPD2 antibody (C-Term)
-
- Target See all NCAPD2 Antibodies
- NCAPD2 (Non-SMC Condensin I Complex, Subunit D2 (NCAPD2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NCAPD2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NCAPD2 antibody was raised against the C terminal of NCAPD2
- Purification
- Affinity purified
- Immunogen
- NCAPD2 antibody was raised using the C terminal of NCAPD2 corresponding to a region with amino acids KAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSTGSRYQPL
- Top Product
- Discover our top product NCAPD2 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NCAPD2 Blocking Peptide, catalog no. 33R-4246, is also available for use as a blocking control in assays to test for specificity of this NCAPD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCAPD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NCAPD2 (Non-SMC Condensin I Complex, Subunit D2 (NCAPD2))
- Alternative Name
- NCAPD2 (NCAPD2 Products)
- Synonyms
- CAP-D2 antibody, CNAP1 antibody, hCAP-D2 antibody, 2810406C15Rik antibody, 2810465G24Rik antibody, mKIAA0159 antibody, RGD1562596 antibody, im:6902697 antibody, si:dkey-175g20.1 antibody, wu:fc13f08 antibody, wu:fx06e10 antibody, non-SMC condensin I complex subunit D2 antibody, non-SMC condensin I complex, subunit D2 antibody, non-SMC condensin I complex subunit D2 S homeolog antibody, condensin complex subunit 1 antibody, NCAPD2 antibody, Ncapd2 antibody, ncapd2.S antibody, CIMG_02087 antibody, BDBG_08990 antibody, MCYG_08389 antibody, VDBG_09812 antibody, MGYG_05811 antibody, ncapd2 antibody
- Background
- NCAPD2 is the regulatory subunit of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases. NCAPD2 may target the condensin complex to DNA via its C-terminal domain.
- Molecular Weight
- 157 kDa (MW of target protein)
-