Septin 11 antibody (N-Term)

Catalog No. ABIN634141

Product Details anti-Septin 11 Antibody

Target: Septin 11 (SEPT11)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Septin 11 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Septin 11 antibody was raised against the N terminal of 40432

Purification: Affinity purified

Immunogen: Septin 11 antibody was raised using the N terminal of 40432 corresponding to a region with amino acids MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGET

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Septin 11 Blocking Peptide, catalog no. 33R-5793, is also available for use as a blocking control in assays to test for specificity of this Septin 11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 40787 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Septin 11

Target: Septin 11 (SEPT11)

Alternative Name: Septin 11 (SEPT11 Products)

Synonyms: 6230410I01Rik antibody, AW548875 antibody, D5Ertd606e antibody, Sept6 antibody, Sep-11 antibody, MGC81799 antibody, SEPT11 antibody, Septin-11 antibody, septin 11 antibody, septin 11 S homeolog antibody, SEPT11 antibody, Sept11 antibody, sept11.S antibody

Background: SEPT11 belongs to the conserved septin family of filament-forming cytoskeletal GTPases that are involved in a variety of cellular functions including cytokinesis and vesicle trafficking.

Molecular Weight: 49 kDa (MW of target protein)