PBK antibody (N-Term)

Catalog No. ABIN634145

The Rabbit Polyclonal anti-PBK antibody has been validated for WB. It is suitable to detect PBK in samples from Human, Mouse and Rat.

Quick Overview for PBK antibody (N-Term) (ABIN634145)

Target: PBK (PDZ Binding Kinase (PBK))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PBK antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PBK Antibody

Binding Specificity: N-Term

Specificity: PBK antibody was raised against the N terminal of PBK

Purification: Affinity purified

Immunogen: PBK antibody was raised using the N terminal of PBK corresponding to a region with amino acids SLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PBK Blocking Peptide, (ABIN5615228), is also available for use as a blocking control in assays to test for specificity of this PBK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PBK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PBK

Target: PBK (PDZ Binding Kinase (PBK))

Alternative Name: PBK

Background: PBK is a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis.

Molecular Weight: 36 kDa (MW of target protein)