PBK antibody (N-Term)
-
- Target See all PBK Antibodies
- PBK (PDZ Binding Kinase (PBK))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PBK antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PBK antibody was raised against the N terminal of PBK
- Purification
- Affinity purified
- Immunogen
- PBK antibody was raised using the N terminal of PBK corresponding to a region with amino acids SLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQ
- Top Product
- Discover our top product PBK Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PBK Blocking Peptide, catalog no. 33R-8581, is also available for use as a blocking control in assays to test for specificity of this PBK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PBK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PBK (PDZ Binding Kinase (PBK))
- Alternative Name
- PBK (PBK Products)
- Synonyms
- PBK antibody, topk antibody, CT84 antibody, Nori-3 antibody, SPK antibody, TOPK antibody, 2810434B10Rik antibody, AW538537 antibody, D14Ertd732e antibody, zgc:92050 antibody, PDZ binding kinase antibody, PDZ binding kinase L homeolog antibody, PBK antibody, pbk antibody, Pbk antibody, pbk.L antibody
- Background
- PBK is a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis.
- Molecular Weight
- 36 kDa (MW of target protein)
-