RPA4 antibody (Middle Region)

Catalog No. ABIN634150

This Rabbit Polyclonal antibody specifically detects RPA4 in WB. It exhibits reactivity toward Human.

Quick Overview for RPA4 antibody (Middle Region) (ABIN634150)

Target: RPA4 (Replication Protein A4, 30kDa (RPA4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPA4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RPA4 Antibody

Binding Specificity: Middle Region

Specificity: RPA4 antibody was raised against the middle region of RPA4

Purification: Affinity purified

Immunogen: RPA4 antibody was raised using the middle region of RPA4 corresponding to a region with amino acids VPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPA4 Blocking Peptide, catalog no. 33R-9743, is also available for use as a blocking control in assays to test for specificity of this RPA4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPA4

Target: RPA4 (Replication Protein A4, 30kDa (RPA4))

Alternative Name: RPA4

Background: Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. RPA4 is the 32 kDa subunit of the RPA, which associates with the 70- and 13 kDa subunits to form a trimeric RPA complex. Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation.

Molecular Weight: 29 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication