MSH5 antibody

Catalog No. ABIN634152

This anti-MSH5 antibody is a Rabbit Polyclonal antibody detecting MSH5 in WB. Suitable for Human and Rat.

Quick Overview for MSH5 antibody (ABIN634152)

Target: MSH5 (MutS Homolog 5 (MSH5))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MSH5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MSH5 Antibody

Purification: Affinity purified

Immunogen: MSH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DENMTRFLGKLASQEHREPKRPEIIFLPSVDFGLEISKQRLLSGNYSFIP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MSH5 Blocking Peptide, (ABIN937301), is also available for use as a blocking control in assays to test for specificity of this MSH5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSH5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MSH5

Target: MSH5 (MutS Homolog 5 (MSH5))

Alternative Name: MSH5

Background: MSH5 is a member of the mutS family of proteins that are involved in DNA mismatch repair or meiotic recombination processes. This protein is similar to a Saccharomyces cerevisiae protein that participates in meiotic segregation fidelity and crossing-over. This protein forms heterooligomers with another member of this family, mutS homolog 4.

Molecular Weight: 93 kDa (MW of target protein)

Pathways: M Phase