Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

MSH5 antibody

MSH5 Reactivity: Human, Rat WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN634152
$836.98
Plus shipping costs $45.00
100 μL
Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target See all MSH5 Antibodies
    MSH5 (MutS Homolog 5 (MSH5))
    Reactivity
    • 16
    • 12
    • 4
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Rat
    Host
    • 16
    Rabbit
    Clonality
    • 16
    Polyclonal
    Conjugate
    • 9
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This MSH5 antibody is un-conjugated
    Application
    • 8
    • 3
    • 2
    Western Blotting (WB)
    Purification
    Affinity purified
    Immunogen
    MSH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DENMTRFLGKLASQEHREPKRPEIIFLPSVDFGLEISKQRLLSGNYSFIP
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    MSH5 Blocking Peptide, catalog no. 33R-1915, is also available for use as a blocking control in assays to test for specificity of this MSH5 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSH5 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    MSH5 (MutS Homolog 5 (MSH5))
    Alternative Name
    MSH5 (MSH5 Products)
    Synonyms
    MSH5 antibody, G7 antibody, MUTSH5 antibody, NG23 antibody, Mut5 antibody, mutS homolog 5 antibody, mutS protein homolog 5 antibody, MSH (MutS Homolog) family antibody, MSH5 antibody, msh5 antibody, LOC100635155 antibody, Msh5 antibody, msh-5 antibody
    Background
    MSH5 is a member of the mutS family of proteins that are involved in DNA mismatch repair or meiotic recombination processes. This protein is similar to a Saccharomyces cerevisiae protein that participates in meiotic segregation fidelity and crossing-over. This protein forms heterooligomers with another member of this family, mutS homolog 4.
    Molecular Weight
    93 kDa (MW of target protein)
    Pathways
    M Phase
You are here:
Support