UBE2C antibody (Middle Region)

Catalog No. ABIN634161

Product Details anti-UBE2C Antibody

Target: UBE2C (Ubiquitin-Conjugating Enzyme E2C (UBE2C))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE2C antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UBE2 C antibody was raised against the middle region of UBE2

Purification: Affinity purified

Immunogen: UBE2 C antibody was raised using the middle region of UBE2 corresponding to a region with amino acids QGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE2C Blocking Peptide, catalog no. 33R-7567, is also available for use as a blocking control in assays to test for specificity of this UBE2C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE2C

Target: UBE2C (Ubiquitin-Conjugating Enzyme E2C (UBE2C))

Alternative Name: UBE2C (UBE2C Products)

Synonyms: LOC458287 antibody, UBCH10 antibody, dJ447F3.2 antibody, 1110015A16Rik antibody, D2Ertd695e antibody, im:7137135 antibody, zgc:123190 antibody, ubiquitin conjugating enzyme E2 C antibody, ubiquitin-conjugating enzyme E2C antibody, ubiquitin conjugating enzyme E2 C L homeolog antibody, ubiquitin conjugating enzyme E2 C S homeolog antibody, UBE2C antibody, NAEGRDRAFT_82946 antibody, ube2c.L antibody, Ube2c antibody, ube2c.S antibody, ube2c antibody

Background: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2C is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell cycle progression.

Molecular Weight: 20 kDa (MW of target protein)

Pathways: Ubiquitin Proteasome Pathway