GTSE1 antibody (Middle Region)
-
- Target See all GTSE1 Antibodies
- GTSE1 (G-2 and S-Phase Expressed 1 (GTSE1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GTSE1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GTSE1 antibody was raised against the middle region of GTSE1
- Purification
- Affinity purified
- Immunogen
- GTSE1 antibody was raised using the middle region of GTSE1 corresponding to a region with amino acids IDLMTNTPDMNKNVAKPSPVVGQLIDLSSPLIQLSPEADKENVDSPLLKF
- Top Product
- Discover our top product GTSE1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GTSE1 Blocking Peptide, catalog no. 33R-3920, is also available for use as a blocking control in assays to test for specificity of this GTSE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTSE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GTSE1 (G-2 and S-Phase Expressed 1 (GTSE1))
- Alternative Name
- GTSE1 (GTSE1 Products)
- Background
- GTSE1 is only expressed in the S and G2 phases of the cell cycle, where it colocalizes with cytoplasmic tubulin and microtubules. In response to DNA damage, the encoded protein accumulates in the nucleus and binds the tumor suppressor protein p53, shuttling it out of the nucleus and repressing its ability to induce apoptosis.
- Molecular Weight
- 76 kDa (MW of target protein)
-