CDK1 antibody (Middle Region)

Catalog No. ABIN634188

This anti-CDK1 antibody is a Rabbit Polyclonal antibody detecting CDK1 in WB. Suitable for Human, Mouse, Rat, Drosophila melanogaster and Arabidopsis.

Quick Overview for CDK1 antibody (Middle Region) (ABIN634188)

Target: CDK1 (Cyclin-Dependent Kinase 1 (CDK1))

Reactivity: Human, Mouse, Rat, Drosophila melanogaster, Arabidopsis

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDK1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CDK1 Antibody

Binding Specificity: Middle Region

Specificity: CDC2 antibody was raised against the middle region of CDC2

Purification: Affinity purified

Immunogen: CDC2 antibody was raised using the middle region of CDC2 corresponding to a region with amino acids CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDC2 Blocking Peptide, (ABIN937029), is also available for use as a blocking control in assays to test for specificity of this CDC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CDK1

Target: CDK1 (Cyclin-Dependent Kinase 1 (CDK1))

Alternative Name: CDC2

Background: The protein encoded by CDC2 is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control.

Molecular Weight: 34 kDa (MW of target protein)

Pathways: Cell Division Cycle, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Activation of Innate immune Response, Mitotic G1-G1/S Phases, DNA Replication, M Phase, Toll-Like Receptors Cascades, Synthesis of DNA