TUBE1 antibody (Middle Region)

Catalog No. ABIN634212

This anti-TUBE1 antibody is a Rabbit Polyclonal antibody detecting TUBE1 in WB. Suitable for Human.

Quick Overview for TUBE1 antibody (Middle Region) (ABIN634212)

Target: TUBE1 (Tubulin, epsilon 1 (TUBE1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TUBE1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TUBE1 Antibody

Binding Specificity: Middle Region

Specificity: Epsilon Tubulin 1 antibody was raised against the middle region of TUBE1

Purification: Affinity purified

Immunogen: Epsilon Tubulin 1 antibody was raised using the middle region of TUBE1 corresponding to a region with amino acids PSGEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Epsilon Tubulin 1 Blocking Peptide, (ABIN5613388), is also available for use as a blocking control in assays to test for specificity of this Epsilon Tubulin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TUBE1

Target: TUBE1 (Tubulin, epsilon 1 (TUBE1))

Alternative Name: epsilon Tubulin 1

Background: This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: Microtubule Dynamics