TUBE1 antibody (Middle Region)

Catalog No. ABIN634213

This Rabbit Polyclonal antibody specifically detects TUBE1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for TUBE1 antibody (Middle Region) (ABIN634213)

Target: TUBE1 (Tubulin, epsilon 1 (TUBE1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TUBE1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TUBE1 Antibody

Binding Specificity: Middle Region

Specificity: Epsilon Tubulin 1 antibody was raised against the middle region of TUBE1

Purification: Affinity purified

Immunogen: Epsilon Tubulin 1 antibody was raised using the middle region of TUBE1 corresponding to a region with amino acids HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Epsilon Tubulin 1 Blocking Peptide, (ABIN939163), is also available for use as a blocking control in assays to test for specificity of this Epsilon Tubulin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TUBE1

Target: TUBE1 (Tubulin, epsilon 1 (TUBE1))

Alternative Name: epsilon Tubulin 1

Background: This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: Microtubule Dynamics