Interleukin enhancer-binding factor 3 (ILF3) (N-Term) antibody
-
- Target See all Interleukin enhancer-binding factor 3 (ILF3) Antibodies
- Interleukin enhancer-binding factor 3 (ILF3)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- ILF3 antibody was raised against the N terminal of ILF3
- Purification
- Affinity purified
- Immunogen
- ILF3 antibody was raised using the N terminal of ILF3 corresponding to a region with amino acids PTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDD
- Top Product
- Discover our top product ILF3 Primary Antibody
-
-
- Application Notes
-
WB: 0.0625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ILF3 Blocking Peptide, catalog no. 33R-7393, is also available for use as a blocking control in assays to test for specificity of this ILF3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ILF3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Interleukin enhancer-binding factor 3 (ILF3)
- Alternative Name
- ILF3 (ILF3 Products)
- Synonyms
- CBTF antibody, DRBF antibody, DRBP76 antibody, MMP4 antibody, MPHOSPH4 antibody, MPP4 antibody, NF-AT-90 antibody, NF110 antibody, NF110b antibody, NF90 antibody, NF90a antibody, NF90b antibody, NFAR antibody, NFAR-1 antibody, NFAR2 antibody, TCP110 antibody, TCP80 antibody, MBII-26 antibody, ilf3 antibody, wu:fb37d07 antibody, wu:fb94b02 antibody, zgc:77030 antibody, 4F.1 antibody, cbtf122 antibody, ilf3-A antibody, ubp3 antibody, ubp4 antibody, xilf3 antibody, interleukin enhancer binding factor 3 antibody, interleukin enhancer binding factor 3b antibody, interleukin enhancer binding factor 3 S homeolog antibody, ILF3 antibody, Ilf3 antibody, ilf3b antibody, ilf3.S antibody
- Background
- ILF3 may facilitate double-stranded RNA-regulated gene expression at the level of post-transcription. ILF3 can act as a translation inhibitory protein which binds to coding sequences of acid beta-glucosidase (GCase) and other mRNAs and functions at the initiation phase of GCase mRNA translation, probably by inhibiting its binding to polysomes. ILF3 can regulate protein arginine N-methyltransferase 1 activity.
- Molecular Weight
- 76 kDa (MW of target protein)
- Pathways
- M Phase
-