Interleukin enhancer-binding factor 3 (ILF3) (N-Term) antibody

Catalog No. ABIN634215

Product Details

Target: Interleukin enhancer-binding factor 3 (ILF3)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: ILF3 antibody was raised against the N terminal of ILF3

Purification: Affinity purified

Immunogen: ILF3 antibody was raised using the N terminal of ILF3 corresponding to a region with amino acids PTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDD

Application Details

Application Notes: WB: 0.0625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ILF3 Blocking Peptide, catalog no. 33R-7393, is also available for use as a blocking control in assays to test for specificity of this ILF3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ILF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Interleukin enhancer-binding factor 3 (ILF3)

Alternative Name: ILF3 (ILF3 Products)

Synonyms: CBTF antibody, DRBF antibody, DRBP76 antibody, MMP4 antibody, MPHOSPH4 antibody, MPP4 antibody, NF-AT-90 antibody, NF110 antibody, NF110b antibody, NF90 antibody, NF90a antibody, NF90b antibody, NFAR antibody, NFAR-1 antibody, NFAR2 antibody, TCP110 antibody, TCP80 antibody, MBII-26 antibody, ilf3 antibody, wu:fb37d07 antibody, wu:fb94b02 antibody, zgc:77030 antibody, 4F.1 antibody, cbtf122 antibody, ilf3-A antibody, ubp3 antibody, ubp4 antibody, xilf3 antibody, interleukin enhancer binding factor 3 antibody, interleukin enhancer binding factor 3b antibody, interleukin enhancer binding factor 3 S homeolog antibody, ILF3 antibody, Ilf3 antibody, ilf3b antibody, ilf3.S antibody

Background: ILF3 may facilitate double-stranded RNA-regulated gene expression at the level of post-transcription. ILF3 can act as a translation inhibitory protein which binds to coding sequences of acid beta-glucosidase (GCase) and other mRNAs and functions at the initiation phase of GCase mRNA translation, probably by inhibiting its binding to polysomes. ILF3 can regulate protein arginine N-methyltransferase 1 activity.

Molecular Weight: 76 kDa (MW of target protein)

Pathways: M Phase