DHX16 antibody

Catalog No. ABIN634220

Product Details anti-DHX16 Antibody

Target: DHX16 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 16 (DHX16))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DHX16 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DHX16 antibody was raised using a synthetic peptide corresponding to a region with amino acids KYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPV

Application Details

Application Notes: WB: 0.125 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DHX16 Blocking Peptide, catalog no. 33R-4749, is also available for use as a blocking control in assays to test for specificity of this DHX16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DHX16

Target: DHX16 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 16 (DHX16))

Alternative Name: DHX16 (DHX16 Products)

Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a functional homolog of fission yeast Prp8 protein involved in cell cycle progression. This gene is mapped to the MHC region on chromosome 6p21.3, a region where many malignant, genetic and autoimmune disease genes are linked.

Molecular Weight: 115 kDa (MW of target protein)