RAD54B antibody
-
- Target See all RAD54B Antibodies
- RAD54B (DNA repair and recombination protein RAD54B (RAD54B))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RAD54B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RAD54 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEV
- Top Product
- Discover our top product RAD54B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RAD54B Blocking Peptide, catalog no. 33R-1865, is also available for use as a blocking control in assays to test for specificity of this RAD54B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD50 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAD54B (DNA repair and recombination protein RAD54B (RAD54B))
- Alternative Name
- RAD54B (RAD54B Products)
- Background
- RAD54B belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA.
- Molecular Weight
- 103 kDa (MW of target protein)
-