RAD54B antibody

Catalog No. ABIN634221

This anti-RAD54B antibody is a Rabbit Polyclonal antibody detecting RAD54B in WB. Suitable for Human, Mouse and Rat.

Quick Overview for RAD54B antibody (ABIN634221)

Target: RAD54B (DNA repair and recombination protein RAD54B (RAD54B))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAD54B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RAD54B Antibody

Purification: Affinity purified

Immunogen: RAD54 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAD54B Blocking Peptide, (ABIN937251), is also available for use as a blocking control in assays to test for specificity of this RAD54B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAD54B

Target: RAD54B (DNA repair and recombination protein RAD54B (RAD54B))

Alternative Name: RAD54B

Background: RAD54B belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA.

Molecular Weight: 103 kDa (MW of target protein)