PCBP4 antibody

Catalog No. ABIN634227

This anti-PCBP4 antibody is a Rabbit Polyclonal antibody detecting PCBP4 in WB. Suitable for Human, Mouse, Rat and Dog.

Quick Overview for PCBP4 antibody (ABIN634227)

Target: PCBP4 (Poly(rC) Binding Protein 4 (PCBP4))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCBP4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PCBP4 Antibody

Purification: Affinity purified

Immunogen: PCBP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTSSQEFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGAGERHV

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCBP4 Blocking Peptide, (ABIN5615236), is also available for use as a blocking control in assays to test for specificity of this PCBP4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCBP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCBP4

Target: PCBP4 (Poly(rC) Binding Protein 4 (PCBP4))

Alternative Name: PCBP4

Background: PCBP4 is a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and have different cellular distributions. This gene is induced by the p53 tumor suppressor, and the protein can suppress cell proliferation by inducing apoptosis and cell cycle arrest in G(2)-M.

Molecular Weight: 47 kDa (MW of target protein)