Kallikrein 10 antibody (KLK10) (N-Term)

Catalog No. ABIN634235

Product Details anti-Kallikrein 10 Antibody

Target: Kallikrein 10 (KLK10)

See all Kallikrein 10 (KLK10) Antibodies

Binding Specificity: N-Term

See all available epitopes across Kallikrein 10 antibodies

• C-Term 11
• AA 225-254 10
• N-Term 9
• AA 21-51 7
• AA 22-51 6
• AA 34-276 6
• AA 1-276 4
• AA 31-274 4
• AA 80-130 3
• AA 167-276 2
• AA 167-277 2
• AA 252-265 2
• AA 35-276 2
• AA 35-84 1
• full length 1

Reactivity: Human

See all available reactivities across Kallikrein 10 antibodies

• Human 78
• Rat 18
• Mouse 17
• Cow 1
• Monkey 1
• Rabbit 1
• Sheep 1

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Kallikrein 10 antibody is un-conjugated

See all available conjugates across Kallikrein 10 antibodies

• Un-conjugated 34
• Biotin 9
• FITC 7
• HRP 5
• APC 4
• PE 4
• Alkaline Phosphatase (AP) 3
• Alexa Fluor 594 2
• Alexa Fluor 680 2
• Alexa Fluor 750 2
• Alexa Fluor 350 1
• Alexa Fluor 488 1
• Alexa Fluor 555 1
• Alexa Fluor 647 1
• Cy3 1
• Cy5 1
• Cy5.5 1
• Cy7 1
• PerCP 1

Application: Western Blotting (WB)

See all available applications across Kallikrein 10 antibodies

• Western Blotting (WB) 54
• ELISA 37
• Immunohistochemistry (IHC) 16
• Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13
• Immunofluorescence (IF) 9
• Flow Cytometry (FACS) 5
• Immunocytochemistry (ICC) 5
• Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 4
• Immunoprecipitation (IP) 4
• Immunofluorescence (fixed cells) (IF/ICC) 4
• Enzyme Immunoassay (EIA) 2
• Immunochromatography (IC) 2
• Radioimmunoassay (RIA) 2
• Immunohistochemistry (Frozen Sections) (IHC (fro)) 1

Specificity: KLK10 antibody was raised against the N terminal of KLK10

Purification: Affinity purified

Immunogen: KLK10 antibody was raised using the N terminal of KLK10 corresponding to a region with amino acids LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLK10 Blocking Peptide, catalog no. 33R-5176, is also available for use as a blocking control in assays to test for specificity of this KLK10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Kallikrein 10

Target: Kallikrein 10 (KLK10)

Alternative Name: KLK10 (KLK10 Antibody Abstract)

Synonyms: KLK10, 2300002A13Rik, NES1, PRSSL1, kallikrein related peptidase 10, kallikrein related-peptidase 10, kallikrein-related peptidase 10, KLK10, Klk10

Background: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers.

Molecular Weight: 30 kDa (MW of target protein)

Pathways: Complement System