Kallikrein 10 antibody (KLK10) (N-Term) Primary Antibody
-
- Target
- Kallikrein 10 (KLK10)
- Binding Specificity
-
N-Term
- Reactivity
-
Human
- Host
- Rabbit
- Clonality
- Polyclonal
- Conjugate
-
This Kallikrein 10 antibody is un-conjugated
- Application
-
Western Blotting (WB)
- Specificity
- KLK10 antibody was raised against the N terminal of KLK10
- Purification
- Affinity purified
- Immunogen
- KLK10 antibody was raised using the N terminal of KLK10 corresponding to a region with amino acids LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTA
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KLK10 Blocking Peptide, catalog no. 33R-5176, is also available for use as a blocking control in assays to test for specificity of this KLK10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Kallikrein 10 (KLK10)
- Alternative Name
- KLK10 (KLK10 Antibody Abstract)
- Synonyms
- KLK10, 2300002A13Rik, NES1, PRSSL1, kallikrein related peptidase 10, kallikrein related-peptidase 10, kallikrein-related peptidase 10, KLK10, Klk10
- Background
- Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers.
- Molecular Weight
- 30 kDa (MW of target protein)
- Pathways
- Complement System