Kallikrein 10 antibody (KLK10) (N-Term) Primary Antibody
KLK10
Reactivity: Human
WB
Host: Rabbit
Polyclonal
camera_alt 1
Catalog No. ABIN634235
$517.86
Plus shipping costs $45.00
50 μg
local_shipping
Shipping to:
United States
Delivery in 9 to 11 Business Days
-
- Target
- Binding Specificity
- N-Term
- Reactivity
- Human
- Host
- Rabbit
- Clonality
- Polyclonal
- Conjugate
- This Kallikrein 10 antibody is un-conjugated
- Application
- Western Blotting (WB)
- Specificity
- KLK10 antibody was raised against the N terminal of KLK10
- Purification
- Affinity purified
- Immunogen
- KLK10 antibody was raised using the N terminal of KLK10 corresponding to a region with amino acids LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTA
-
- Target
- Alternative Name
- KLK10 (KLK10 Antibody Abstract)
- Background
- Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers.
- Molecular Weight
- 30 kDa (MW of target protein)
- Pathways
- Complement System
-
- Application Notes
- WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
KLK10 Blocking Peptide, catalog no. 33R-5176, is also available for use as a blocking control in assays to test for specificity of this KLK10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
You are here:
