Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Kallikrein 10 antibody (KLK10) (N-Term) Primary Antibody

KLK10 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN634235
$647.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    Kallikrein 10 (KLK10)
    Binding Specificity
    N-Term
    • 11
    • 10
    • 9
    • 7
    • 6
    • 6
    • 4
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    Reactivity
    Human
    • 78
    • 18
    • 17
    • 1
    • 1
    • 1
    • 1
    Host
    Rabbit
    Clonality
    Polyclonal
    Conjugate
    This Kallikrein 10 antibody is un-conjugated
    • 34
    • 9
    • 7
    • 5
    • 4
    • 4
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    Western Blotting (WB)
    • 54
    • 37
    • 16
    • 13
    • 9
    • 5
    • 5
    • 4
    • 4
    • 4
    • 2
    • 2
    • 2
    • 1
    Specificity
    KLK10 antibody was raised against the N terminal of KLK10
    Purification
    Affinity purified
    Immunogen
    KLK10 antibody was raised using the N terminal of KLK10 corresponding to a region with amino acids LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTA
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    KLK10 Blocking Peptide, catalog no. 33R-5176, is also available for use as a blocking control in assays to test for specificity of this KLK10 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK10 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    Kallikrein 10 (KLK10)
    Alternative Name
    KLK10 (KLK10 Antibody Abstract)
    Synonyms
    KLK10, 2300002A13Rik, NES1, PRSSL1, kallikrein related peptidase 10, kallikrein related-peptidase 10, kallikrein-related peptidase 10, KLK10, Klk10
    Background
    Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers.
    Molecular Weight
    30 kDa (MW of target protein)
    Pathways
    Complement System
You are here:
help Support