HDAC9 antibody (Middle Region)

Catalog No. ABIN634236

This anti-HDAC9 antibody is a Rabbit Polyclonal antibody detecting HDAC9 in WB. Suitable for Human, Rat and Mouse.

Quick Overview for HDAC9 antibody (Middle Region) (ABIN634236)

Target: HDAC9 (Histone Deacetylase 9 (HDAC9))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HDAC9 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HDAC9 Antibody

Binding Specificity: Middle Region

Specificity: HDAC9 antibody was raised against the middle region of HDAC9

Purification: Affinity purified

Immunogen: HDAC9 antibody was raised using the middle region of HDAC9 corresponding to a region with amino acids GQVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HDAC9 Blocking Peptide, (ABIN938903), is also available for use as a blocking control in assays to test for specificity of this HDAC9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HDAC9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HDAC9

Target: HDAC9 (Histone Deacetylase 9 (HDAC9))

Alternative Name: HDAC9

Background: Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. HDAC9 has sequence homology to members of the histone deacetylase family. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. HDAC9 may play a role in hematopoiesis.

Molecular Weight: 66 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development