TdT antibody (N-Term)

Catalog No. ABIN634239

This anti-TdT antibody is a Rabbit Polyclonal antibody detecting TdT in WB. Suitable for Human, Mouse and Rat.

Quick Overview for TdT antibody (N-Term) (ABIN634239)

Target: TdT (DNTT) (Deoxynucleotidyltransferase, terminal (DNTT))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TdT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TdT Antibody

Binding Specificity: N-Term

Specificity: DNTT antibody was raised against the N terminal of DNTT

Purification: Affinity purified

Immunogen: DNTT antibody was raised using the N terminal of DNTT corresponding to a region with amino acids FQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNSG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DNTT Blocking Peptide, (ABIN938414), is also available for use as a blocking control in assays to test for specificity of this DNTT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNTT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TdT

Target: TdT (DNTT) (Deoxynucleotidyltransferase, terminal (DNTT))

Alternative Name: DNTT

Background: DNTT is a template-independent DNA polymerase that catalyzes the addition of deoxynucleotides to the 3'-hydroxyl terminus of oligonucleotide primers. In vivo, DNTT is expressed in a restricted population of normal and malignant pre-B and pre-T lymphocytes during early differentiation, where it generates antigen receptor diversity by synthesizing non-germ line elements (N-regions) at the junctions of rearranged Ig heavy chain and T cell receptor geneegments.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: DNA Damage Repair