K-RAS antibody (N-Term)

Catalog No. ABIN634246

Product Details anti-K-RAS Antibody

Target: K-RAS (KRAS) (GTPase Kras (KRAS))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse, Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This K-RAS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KRAS antibody was raised against the N terminal of KRAS

Purification: Affinity purified

Immunogen: KRAS antibody was raised using the N terminal of KRAS corresponding to a region with amino acids TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KRAS Blocking Peptide, catalog no. 33R-9058, is also available for use as a blocking control in assays to test for specificity of this KRAS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRAS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for K-RAS

Target: K-RAS (KRAS) (GTPase Kras (KRAS))

Alternative Name: KRAS (KRAS Products)

Target Type: Viral Protein

Background: KRAS is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma.

Molecular Weight: 22 kDa (MW of target protein)