RBM14 antibody (N-Term)

Catalog No. ABIN634248

Product Details anti-RBM14 Antibody

Target: RBM14 (RNA Binding Motif Protein 14 (RBM14))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBM14 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RBM14 antibody was raised against the N terminal of RBM14

Purification: Affinity purified

Immunogen: RBM14 antibody was raised using the N terminal of RBM14 corresponding to a region with amino acids YAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGD

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBM14 Blocking Peptide, catalog no. 33R-10047, is also available for use as a blocking control in assays to test for specificity of this RBM14 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBM14

Target: RBM14 (RNA Binding Motif Protein 14 (RBM14))

Alternative Name: RBM14 (RBM14 Products)

Synonyms: im:7053198 antibody, wu:fc08a04 antibody, zgc:110682 antibody, sip antibody, coaa antibody, psp2 antibody, sytip1 antibody, tmem137 antibody, MGC52864 antibody, MGC132117 antibody, MGC75876 antibody, RBM14 antibody, RBM4 antibody, COAA antibody, PSP2 antibody, SIP antibody, SYTIP1 antibody, TMEM137 antibody, 1300007E16Rik antibody, Sytip antibody, p16 antibody, p16K antibody, CoAA antibody, rbm14 antibody, zgc:85696 antibody, RNA binding motif protein 14a antibody, RNA binding motif protein 14 L homeolog antibody, RNA binding motif protein 14 antibody, RNA binding motif protein 14b antibody, rbm14a antibody, rbm14.L antibody, rbm14 antibody, RBM14 antibody, Rbm14 antibody, rbm14b antibody

Background: RBM14 contains 2 RRM (RNA recognition motif) domains. Isoform 1 may function as a nuclear receptor coactivator, enhancing transcription through other coactivators such as NCOA6 and CITED1. Isoform 2, functions as a transcriptional repressor, modulating transcriptional activities of coactivators including isoform 1, NCOA6 and CITED1.

Molecular Weight: 69 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway