PDGFB antibody (N-Term)
-
- Target See all PDGFB Antibodies
- PDGFB (Platelet Derived Growth Factor Subunit B (PDGFB))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PDGFB antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PDGFB antibody was raised against the N terminal of PDGFB
- Purification
- Affinity purified
- Immunogen
- PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD
- Top Product
- Discover our top product PDGFB Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PDGFB Blocking Peptide, catalog no. 33R-6853, is also available for use as a blocking control in assays to test for specificity of this PDGFB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDGFB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDGFB (Platelet Derived Growth Factor Subunit B (PDGFB))
- Alternative Name
- PDGFB (PDGFB Products)
- Background
- PDGFB is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor.
- Molecular Weight
- 27 kDa (MW of target protein)
- Pathways
- RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Carbohydrate Metabolic Process, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling
-