ECT2 antibody (Middle Region)

Catalog No. ABIN634287

The Rabbit Polyclonal anti-ECT2 antibody (ABIN634287) specifically detects ECT2 in WB. The antibody is reactive with Human and Mouse samples.

Quick Overview for ECT2 antibody (Middle Region) (ABIN634287)

Target: ECT2 (Epithelial Cell Transforming Sequence 2 Oncogene (ECT2))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ECT2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ECT2 Antibody

Binding Specificity: Middle Region

Specificity: ECT2 antibody was raised against the middle region of ECT2

Purification: Affinity purified

Immunogen: ECT2 antibody was raised using the middle region of ECT2 corresponding to a region with amino acids KKHTADENPDKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ECT2 Blocking Peptide, (ABIN939857), is also available for use as a blocking control in assays to test for specificity of this ECT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ECT2

Target: ECT2 (Epithelial Cell Transforming Sequence 2 Oncogene (ECT2))

Alternative Name: ECT2

Background: ECT2 is a transforming protein that is related to Rho-specific exchange factors and yeast cell cycle regulators. The expression of ECT2 is elevated with the onset of DNA synthesis and remains elevated during G2 and M phases. In situ hybridization analysis showed that expression is at a high level in cells undergoing mitosis in regenerating liver. Thus, this protein is expressed in a cell cycle-dependent manner during liver regeneration, and is thought to have an important role in the regulation of cytokinesis.

Molecular Weight: 100 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway, Cell-Cell Junction Organization