ECT2 antibody (Middle Region)
-
- Target See all ECT2 Antibodies
- ECT2 (Epithelial Cell Transforming Sequence 2 Oncogene (ECT2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ECT2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ECT2 antibody was raised against the middle region of ECT2
- Purification
- Affinity purified
- Immunogen
- ECT2 antibody was raised using the middle region of ECT2 corresponding to a region with amino acids KKHTADENPDKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDG
- Top Product
- Discover our top product ECT2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ECT2 Blocking Peptide, catalog no. 33R-4471, is also available for use as a blocking control in assays to test for specificity of this ECT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ECT2 (Epithelial Cell Transforming Sequence 2 Oncogene (ECT2))
- Alternative Name
- ECT2 (ECT2 Products)
- Background
- ECT2 is a transforming protein that is related to Rho-specific exchange factors and yeast cell cycle regulators. The expression of ECT2 is elevated with the onset of DNA synthesis and remains elevated during G2 and M phases. In situ hybridization analysis showed that expression is at a high level in cells undergoing mitosis in regenerating liver. Thus, this protein is expressed in a cell cycle-dependent manner during liver regeneration, and is thought to have an important role in the regulation of cytokinesis.
- Molecular Weight
- 100 kDa (MW of target protein)
- Pathways
- Neurotrophin Signaling Pathway, Cell-Cell Junction Organization
-