S100A9 antibody (N-Term)

Catalog No. ABIN634289

Product Details anti-S100A9 Antibody

Target: S100A9 (S100 Calcium Binding Protein A9 (S100A9))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This S100A9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: S100 A9 antibody was raised against the N terminal of S100 9

Purification: Affinity purified

Immunogen: S100 A9 antibody was raised using the N terminal of S100 9 corresponding to a region with amino acids MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

S100A9 Blocking Peptide, catalog no. 33R-6535, is also available for use as a blocking control in assays to test for specificity of this S100A9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of S100 9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for S100A9

Target: S100A9 (S100 Calcium Binding Protein A9 (S100A9))

Alternative Name: S100A9 (S100A9 Products)

Synonyms: 60B8AG antibody, CAGB antibody, CFAG antibody, CGLB antibody, L1AG antibody, LIAG antibody, MAC387 antibody, MIF antibody, MRP14 antibody, NIF antibody, P14 antibody, Mrp14 antibody, S100A9 antibody, MRP-14 antibody, p14 antibody, 60B8Ag antibody, AW546964 antibody, BEE22 antibody, Cagb antibody, GAGB antibody, L1Ag antibody, S100 calcium binding protein A9 antibody, S100 calcium binding protein A9 (calgranulin B) antibody, S100A9 antibody, S100a9 antibody

Background: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells.

Molecular Weight: 13 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Positive Regulation of Endopeptidase Activity, S100 Proteins