GRF2 antibody

Catalog No. ABIN634290

This anti-GRF2 antibody is a Rabbit Polyclonal antibody detecting GRF2 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for GRF2 antibody (ABIN634290)

Target: GRF2 (RAPGEF1) (Rap Guanine Nucleotide Exchange Factor (GEF) 1 (RAPGEF1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GRF2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GRF2 Antibody

Purification: Affinity purified

Immunogen: RAPGEF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAPGEF1 Blocking Peptide, (ABIN5615757), is also available for use as a blocking control in assays to test for specificity of this RAPGEF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAPGEF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GRF2

Target: GRF2 (RAPGEF1) (Rap Guanine Nucleotide Exchange Factor (GEF) 1 (RAPGEF1))

Alternative Name: RAPGEF1

Background: RAPGEF1 is a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade protein may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation.

Molecular Weight: 120 kDa (MW of target protein)

Pathways: Interferon-gamma Pathway, Neurotrophin Signaling Pathway, Platelet-derived growth Factor Receptor Signaling, Signaling of Hepatocyte Growth Factor Receptor