ARF6 antibody (Middle Region)

Catalog No. ABIN634294

This Rabbit Polyclonal antibody specifically detects ARF6 in WB. It exhibits reactivity toward Human, Rat, Mouse and Drosophila melanogaster.

Quick Overview for ARF6 antibody (Middle Region) (ABIN634294)

Target: ARF6 (ADP-Ribosylation Factor 6 (ARF6))

Reactivity: Human, Rat, Mouse, Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARF6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ARF6 Antibody

Binding Specificity: Middle Region

Specificity: ARF6 antibody was raised against the middle region of ARF6

Purification: Affinity purified

Immunogen: ARF6 antibody was raised using the middle region of ARF6 corresponding to a region with amino acids REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARF6 Blocking Peptide, (ABIN5612137), is also available for use as a blocking control in assays to test for specificity of this ARF6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARF6

Target: ARF6 (ADP-Ribosylation Factor 6 (ARF6))

Alternative Name: ARF6

Background: ARF6 is a member of the human ARF family, which is part of the RAS superfamily. They are small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. ARF6 is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling.

Molecular Weight: 20 kDa (MW of target protein)

Pathways: Steroid Hormone Mediated Signaling Pathway, Regulation of Actin Filament Polymerization, SARS-CoV-2 Protein Interactome