RGS3 antibody (C-Term)

Catalog No. ABIN634296

Product Details anti-RGS3 Antibody

Target: RGS3 (Regulator of G-Protein Signaling 3 (RGS3))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RGS3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RGS3 antibody was raised against the C terminal of RGS3

Purification: Affinity purified

Immunogen: RGS3 antibody was raised using the C terminal of RGS3 corresponding to a region with amino acids KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL

Application Details

Application Notes: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RGS3 Blocking Peptide, catalog no. 33R-4300, is also available for use as a blocking control in assays to test for specificity of this RGS3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RGS3

Target: RGS3 (Regulator of G-Protein Signaling 3 (RGS3))

Alternative Name: RGS3 (RGS3 Products)

Synonyms: RGS3 antibody, MGC115680 antibody, C2PA antibody, RGP3 antibody, 4930506N09Rik antibody, C2PA-RGS3 antibody, C2pa antibody, PDZ-RGS3 antibody, RGS3S antibody, SRB-RGS antibody, regulator of G protein signaling 3 antibody, regulator of G-protein signaling 3 L homeolog antibody, regulator of G-protein signaling 3 antibody, RGS3 antibody, rgs3.L antibody, Rgs3 antibody

Background: RGS3 inhibits signal transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.

Molecular Weight: 101 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling