STAMBP antibody (N-Term)

Catalog No. ABIN634314

Product Details anti-STAMBP Antibody

Target: STAMBP (STAM Binding Protein (STAMBP))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STAMBP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: STAMBP antibody was raised against the N terminal of STAMBP

Purification: Affinity purified

Immunogen: STAMBP antibody was raised using the N terminal of STAMBP corresponding to a region with amino acids SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STAMBP Blocking Peptide, catalog no. 33R-8355, is also available for use as a blocking control in assays to test for specificity of this STAMBP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAMBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STAMBP

Target: STAMBP (STAM Binding Protein (STAMBP))

Alternative Name: STAMBP (STAMBP Products)

Synonyms: AMSH antibody, 5330424L14Rik antibody, 5730422L11Rik antibody, AW107289 antibody, Amsh antibody, mKIAA4198 antibody, stambp antibody, zgc:66147 antibody, STAM binding protein antibody, Stam binding protein antibody, STAM binding protein a antibody, STAMBP antibody, Stambp antibody, stambpa antibody

Background: Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. STAMBP binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression.

Molecular Weight: 48 kDa (MW of target protein)