SNX5 antibody (N-Term)

Catalog No. ABIN634321

Product Details anti-SNX5 Antibody

Target: SNX5 (Sorting Nexin 5 (SNX5))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNX5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SNX5 antibody was raised against the N terminal of SNX5

Purification: Affinity purified

Immunogen: SNX5 antibody was raised using the N terminal of SNX5 corresponding to a region with amino acids FVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNX5 Blocking Peptide, catalog no. 33R-3126, is also available for use as a blocking control in assays to test for specificity of this SNX5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNX5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNX5

Target: SNX5 (Sorting Nexin 5 (SNX5))

Alternative Name: SNX5 (SNX5 Products)

Synonyms: 0910001N05Rik antibody, 1810032P22Rik antibody, AU019504 antibody, D2Ertd52e antibody, id:ibd5091 antibody, wu:fa66c10 antibody, wu:fi28h04 antibody, zgc:55769 antibody, SNX5 antibody, snx5 antibody, sorting nexin 5 antibody, sorting nexin 5 S homeolog antibody, SNX5 antibody, Snx5 antibody, snx5.S antibody, snx5 antibody

Background: SNX5 is a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein binds to fanconi anemia complementation group A protein, but its function is unknown.

Molecular Weight: 47 kDa (MW of target protein)